PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013607408.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MIKC_MADS
Protein Properties Length: 208aa    MW: 24145 Da    PI: 9.1544
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013607408.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.64.5e-25958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien  nr vtfskRrng+ KKA+E+ vLCda+va+i+f+s+gk+ +y+
  XP_013607408.1  9 KRIENVNNRVVTFSKRRNGLVKKAKEITVLCDAKVALIVFASNGKMTDYC 58
                    79*********************************************997 PP

2K-box78.41.8e-26721702100
           K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                     qk sgk+l++ak+e+l++e++k+kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+++e++l k+R++++e+l+++ ++ +++ +e+++   +L++
  XP_013607408.1  72 QKLSGKKLWDAKHENLSNEIDKIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAVEHGLDKVRDHQMEYLMTKRRNEKMMVEENRQLSFQLQQ 166
                     78999****************************************************************************************** PP

           K-box  97 klee 100
                     + +e
  XP_013607408.1 167 QEME 170
                     9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.0E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.151161IPR002100Transcription factor, MADS-box
CDDcd002651.34E-36280No hitNo description
SuperFamilySSF554554.71E-33296IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-263859IPR002100Transcription factor, MADS-box
PfamPF014868.3E-1782164IPR002487Transcription factor, K-box
PROSITE profilePS5129714.02584170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGRGKIEIKR IENVNNRVVT FSKRRNGLVK KAKEITVLCD AKVALIVFAS NGKMTDYCCP  60
SMDLGAMLDQ FQKLSGKKLW DAKHENLSNE IDKIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHAVEH GLDKVRDHQM EYLMTKRRNE KMMVEENRQL SFQLQQQEME IASNARGMMM  180
RDHDAQFGYR VQPIQPNLQE KIMSLVID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P3e-15163163Myocyte-specific enhancer factor 2B
1tqe_Q3e-15163163Myocyte-specific enhancer factor 2B
1tqe_R3e-15163163Myocyte-specific enhancer factor 2B
1tqe_S3e-15163163Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9679630.0KC967963.1 Brassica oleracea var. viridis PI.c (PI.c) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607408.11e-153PREDICTED: floral homeotic protein PISTILLATA-like isoform X1
SwissprotP480071e-146PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLS5ZGM01e-153S5ZGM0_BRAOV; PI.c
STRINGAT5G20240.11e-144(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-148MIKC_MADS family protein